Search clinical trials for: Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL

Total 4 results

Inge Marie Svane

Completed

Dual Vaccine Trial in Myeloproliferative Neoplasms

Polycythemia Vera | Essential Thrombocythemia

Denmark
National Cancer Institute (NCI)

Completed

Booster Vaccination in Preventing Disease Recurrence in Previously Vaccinated Patients With Melanoma That Has Been Removed By Surgery

Stage IV Skin Melanoma | Recurrent Melanoma | Stage IIIB Skin Melanoma | Stage IIIC Skin Melanoma | Stage IIA Skin Melanoma | Stage IIB Skin Melanoma | Stage IIC Skin Melanoma | Stage IIIA Skin Melanoma | Stage IA Skin Melanoma | Stage IB Skin Melanoma

United States
H. Lee Moffitt Cancer Center and Research Institute
National Cancer Institute (NCI)

Completed

Dendritic Cell Vaccination During Lymphoid Reconstruction

Intraocular Melanoma | Melanoma (Skin)

United States
Mayo Clinic

Recruiting

A Vaccine (PDS0101) Alone or in Combination With Pembrolizumab for the Treatment of Locally Advanced Human Papillomavirus-Associated Oropharynx Cancer

Clinical Stage III HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 | Stage IVA Oropharyngeal (p16-Negative) Carcinoma AJCC v8 | Stage IVB Oropharyngeal (p16-Negative) Carcinoma AJCC v8 | Human Papillomavirus-Related Carcinoma | Locally Advanced Oropharyngeal Carcinoma

United States

3

Subscribe